SCOP 1.67: Domain d1or7f_: 1or7 F:

Lineage for d1or7f_ (1or7 F:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.180: N-terminal, cytoplasmic domain of anti-sigmaE factor RseA [89068] (1 superfamily)
   4 helices; irregular array

4. Superfamily a.180.1: N-terminal, cytoplasmic domain of anti-sigmaE factor RseA [89069] (1 family)

5. Family a.180.1.1: N-terminal, cytoplasmic domain of anti-sigmaE factor RseA [89070] (1 protein)

6. Protein N-terminal, cytoplasmic domain of anti-sigmaE factor RseA [89071] (1 species)

7. Species Escherichia coli [TaxId:562] [89072] (1 PDB entry)

8. Domain d1or7f_: 1or7 F: [87337]
   Other proteins in same PDB: d1or7a1, d1or7a2, d1or7b1, d1or7b2

Details for d1or7f_

PDB Entry: 1or7, 2 Å

PDB Description: Crystal Structure of Escherichia coli sigmaE with the Cytoplasmic Domain of its Anti-sigma RseA

SCOP Domain Sequences for d1or7f_:

Sequence; same for both SEQRES and ATOM records:

>d1or7f_ a.180.1.1 (F:) N-terminal, cytoplasmic domain of anti-sigmaE factor RseA {Escherichia coli}
mqkeqlsalmdgetldsellnelahnpemqktwesyhlirdsmrgdtpevlhfdissrvm
aaie

Timeline for d1or7f_:

• d1or7f_ first appeared in SCOP 1.65
  
• d1or7f_ appears in SCOP 1.69
  
• d1or7f_ appears in the current release, SCOPe 2.08