Lineage for d1or7c_ (1or7 C:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 287056Fold a.180: N-terminal, cytoplasmic domain of anti-sigmaE factor RseA [89068] (1 superfamily)
    4 helices; irregular array
  4. 287057Superfamily a.180.1: N-terminal, cytoplasmic domain of anti-sigmaE factor RseA [89069] (1 family) (S)
  5. 287058Family a.180.1.1: N-terminal, cytoplasmic domain of anti-sigmaE factor RseA [89070] (1 protein)
  6. 287059Protein N-terminal, cytoplasmic domain of anti-sigmaE factor RseA [89071] (1 species)
  7. 287060Species Escherichia coli [TaxId:562] [89072] (1 PDB entry)
  8. 287061Domain d1or7c_: 1or7 C: [87336]
    Other proteins in same PDB: d1or7a1, d1or7a2, d1or7b1, d1or7b2

Details for d1or7c_

PDB Entry: 1or7 (more details), 2 Å

PDB Description: Crystal Structure of Escherichia coli sigmaE with the Cytoplasmic Domain of its Anti-sigma RseA

SCOP Domain Sequences for d1or7c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1or7c_ a.180.1.1 (C:) N-terminal, cytoplasmic domain of anti-sigmaE factor RseA {Escherichia coli}
mqkeqlsalmdgetldsellnelahnpemqktwesyhlirdsmrgdtpevlhfdissrvm
aaieee

SCOP Domain Coordinates for d1or7c_:

Click to download the PDB-style file with coordinates for d1or7c_.
(The format of our PDB-style files is described here.)

Timeline for d1or7c_: