| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.177: Sigma2 domain of RNA polymerase sigma factors [88945] (1 superfamily) multihelical; consists of a conserved 4-helical core and a variable insert subdomain |
Superfamily a.177.1: Sigma2 domain of RNA polymerase sigma factors [88946] (1 family) ![]() |
| Family a.177.1.1: Sigma2 domain of RNA polymerase sigma factors [88947] (5 proteins) |
| Protein SigmaE factor (RpoE) [89120] (1 species) |
| Species Escherichia coli [TaxId:562] [89121] (1 PDB entry) |
| Domain d1or7b2: 1or7 B:-1-91 [87335] Other proteins in same PDB: d1or7a1, d1or7b1, d1or7c_, d1or7f_ |
PDB Entry: 1or7 (more details), 2 Å
SCOPe Domain Sequences for d1or7b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1or7b2 a.177.1.1 (B:-1-91) SigmaE factor (RpoE) {Escherichia coli [TaxId: 562]}
shmseqltdqvlvervqkgdqkafnllvvryqhkvaslvsryvpsgdvpdvvqeafikay
raldsfrgdsafytwlyriavntaknylvaqgr
Timeline for d1or7b2:
View in 3DDomains from other chains: (mouse over for more information) d1or7a1, d1or7a2, d1or7c_, d1or7f_ |