Lineage for d1or7b2 (1or7 B:-1-91)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 450240Fold a.177: Sigma2 domain of RNA polymerase sigma factors [88945] (1 superfamily)
    multihelical; consists of a conserved 4-helical core and a variable insert subdomain
  4. 450241Superfamily a.177.1: Sigma2 domain of RNA polymerase sigma factors [88946] (1 family) (S)
  5. 450242Family a.177.1.1: Sigma2 domain of RNA polymerase sigma factors [88947] (5 proteins)
  6. 450266Protein SigmaE factor (RpoE) [89120] (1 species)
  7. 450267Species Escherichia coli [TaxId:562] [89121] (1 PDB entry)
  8. 450269Domain d1or7b2: 1or7 B:-1-91 [87335]
    Other proteins in same PDB: d1or7a1, d1or7b1, d1or7c_, d1or7f_

Details for d1or7b2

PDB Entry: 1or7 (more details), 2 Å

PDB Description: Crystal Structure of Escherichia coli sigmaE with the Cytoplasmic Domain of its Anti-sigma RseA

SCOP Domain Sequences for d1or7b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1or7b2 a.177.1.1 (B:-1-91) SigmaE factor (RpoE) {Escherichia coli}
shmseqltdqvlvervqkgdqkafnllvvryqhkvaslvsryvpsgdvpdvvqeafikay
raldsfrgdsafytwlyriavntaknylvaqgr

SCOP Domain Coordinates for d1or7b2:

Click to download the PDB-style file with coordinates for d1or7b2.
(The format of our PDB-style files is described here.)

Timeline for d1or7b2: