Lineage for d1or7b1 (1or7 B:120-190)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2695832Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families) (S)
  5. 2695870Family a.4.13.2: Sigma4 domain [88665] (5 proteins)
  6. 2695913Protein SigmaE factor (RpoE) [88993] (1 species)
  7. 2695914Species Escherichia coli [TaxId:562] [88994] (2 PDB entries)
  8. 2695916Domain d1or7b1: 1or7 B:120-190 [87334]
    Other proteins in same PDB: d1or7a2, d1or7a3, d1or7b2, d1or7b3, d1or7c_, d1or7f_

Details for d1or7b1

PDB Entry: 1or7 (more details), 2 Å

PDB Description: Crystal Structure of Escherichia coli sigmaE with the Cytoplasmic Domain of its Anti-sigma RseA
PDB Compounds: (B:) RNA polymerase sigma-E factor

SCOPe Domain Sequences for d1or7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1or7b1 a.4.13.2 (B:120-190) SigmaE factor (RpoE) {Escherichia coli [TaxId: 562]}
nlmlseelrqivfrtieslpedlrmaitlreldglsyeeiaaimdcpvgtvrsrifrare
aidnkvqplir

SCOPe Domain Coordinates for d1or7b1:

Click to download the PDB-style file with coordinates for d1or7b1.
(The format of our PDB-style files is described here.)

Timeline for d1or7b1: