Lineage for d1or5a_ (1or5 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1993360Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1993361Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 1993362Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins)
  6. 1993413Protein Frenolicin polyketide synthase acyl carrier protein, Fren ACP [89038] (1 species)
  7. 1993414Species Streptomyces roseofulvus [TaxId:33902] [89039] (1 PDB entry)
  8. 1993415Domain d1or5a_: 1or5 A: [87331]

Details for d1or5a_

PDB Entry: 1or5 (more details)

PDB Description: solution structure of the holo-form of the frenolicin acyl carrier protein, minimized mean structure
PDB Compounds: (A:) Acyl carrier protein

SCOPe Domain Sequences for d1or5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1or5a_ a.28.1.1 (A:) Frenolicin polyketide synthase acyl carrier protein, Fren ACP {Streptomyces roseofulvus [TaxId: 33902]}
saltvddlkkllaetageddsvdlageldtpfvdlgydslalletaavlqqrygialtde
tvgrlgtprelldevnttpata

SCOPe Domain Coordinates for d1or5a_:

Click to download the PDB-style file with coordinates for d1or5a_.
(The format of our PDB-style files is described here.)

Timeline for d1or5a_: