Lineage for d1oqxb1 (1oqx B:236-341)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655804Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)
  7. 655805Species Human (Homo sapiens) [TaxId:9606] [88585] (25 PDB entries)
  8. 655834Domain d1oqxb1: 1oqx B:236-341 [87327]
    Other proteins in same PDB: d1oqxa2, d1oqxb2, d1oqxc_, d1oqxd_
    part of a Fc
    complexed with fuc, man, nag
    part of a Fc

Details for d1oqxb1

PDB Entry: 1oqx (more details), 2.6 Å

PDB Description: g-2 glycovariant of human igg fc bound to minimized version of protein a called z34c
PDB Compounds: (B:) immunoglobulin gamma-1 heavy chain constant region

SCOP Domain Sequences for d1oqxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oqxb1 b.1.1.2 (B:236-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]}
ggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeq
ynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakg

SCOP Domain Coordinates for d1oqxb1:

Click to download the PDB-style file with coordinates for d1oqxb1.
(The format of our PDB-style files is described here.)

Timeline for d1oqxb1: