Lineage for d1oqxa1 (1oqx A:236-341)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 289511Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)
  7. 289512Species Human (Homo sapiens) [TaxId:9606] [88585] (19 PDB entries)
  8. 289526Domain d1oqxa1: 1oqx A:236-341 [87325]
    Other proteins in same PDB: d1oqxa2, d1oqxb2, d1oqxc_, d1oqxd_

Details for d1oqxa1

PDB Entry: 1oqx (more details), 2.6 Å

PDB Description: G-2 glycovariant of human IgG Fc bound to minimized version of Protein A called Z34C

SCOP Domain Sequences for d1oqxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oqxa1 b.1.1.2 (A:236-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens)}
ggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeq
ynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakg

SCOP Domain Coordinates for d1oqxa1:

Click to download the PDB-style file with coordinates for d1oqxa1.
(The format of our PDB-style files is described here.)

Timeline for d1oqxa1: