Class b: All beta proteins [48724] (126 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [88585] (19 PDB entries) |
Domain d1oqxa1: 1oqx A:236-341 [87325] Other proteins in same PDB: d1oqxa2, d1oqxb2, d1oqxc_, d1oqxd_ |
PDB Entry: 1oqx (more details), 2.6 Å
SCOP Domain Sequences for d1oqxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oqxa1 b.1.1.2 (A:236-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens)} ggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeq ynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakg
Timeline for d1oqxa1:
View in 3D Domains from other chains: (mouse over for more information) d1oqxb1, d1oqxb2, d1oqxc_, d1oqxd_ |