Lineage for d1oqwb_ (1oqw B:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 600978Fold d.24: Pili subunits [54522] (1 superfamily)
    contains very long N-terminal helix, which end is packed against beta-sheet
  4. 600979Superfamily d.24.1: Pili subunits [54523] (3 families) (S)
    bacterial filament proteins
  5. 600980Family d.24.1.1: Pilin [54524] (4 proteins)
  6. 600992Protein Type IV Pilin Pak [109620] (1 species)
  7. 600993Species Pseudomonas aeruginosa [TaxId:287] [54527] (2 PDB entries)
  8. 600996Domain d1oqwb_: 1oqw B: [87324]

Details for d1oqwb_

PDB Entry: 1oqw (more details), 2 Å

PDB Description: Full-Length PAK Pilin from Pseudomonas aeruginosa

SCOP Domain Sequences for d1oqwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oqwb_ d.24.1.1 (B:) Type IV Pilin Pak {Pseudomonas aeruginosa}
ftlielmivvaiigilaaiaipqyqnyvarsegasalasvnplkttveealsrgwsvksg
tgtedatkkevplgvaadanklgtialkpdpadgtaditltftmggagpknkgkiitltr
taadglwkctsdqdeqfipkgcsr

SCOP Domain Coordinates for d1oqwb_:

Click to download the PDB-style file with coordinates for d1oqwb_.
(The format of our PDB-style files is described here.)

Timeline for d1oqwb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1oqwa_