SCOPe 2.08: Domain d1oqwb_: 1oqw B:

Lineage for d1oqwb_ (1oqw B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.24: Pili subunits [54522] (1 superfamily)
   contains very long N-terminal helix, which end is packed against beta-sheet

4. Superfamily d.24.1: Pili subunits [54523] (8 families)
   bacterial filament proteins

5. Family d.24.1.1: Pilin [54524] (5 proteins)

6. Protein Type IV Pilin Pak [109620] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [54527] (3 PDB entries)

8. Domain d1oqwb_: 1oqw B: [87324]

Details for d1oqwb_

PDB Entry: 1oqw, 2 Å

PDB Description: Full-Length PAK Pilin from Pseudomonas aeruginosa

PDB Compounds: (B:) fimbrial protein

SCOPe Domain Sequences for d1oqwb_:

Sequence; same for both SEQRES and ATOM records:

>d1oqwb_ d.24.1.1 (B:) Type IV Pilin Pak {Pseudomonas aeruginosa [TaxId: 287]}
ftlielmivvaiigilaaiaipqyqnyvarsegasalasvnplkttveealsrgwsvksg
tgtedatkkevplgvaadanklgtialkpdpadgtaditltftmggagpknkgkiitltr
taadglwkctsdqdeqfipkgcsr

Timeline for d1oqwb_:

• d1oqwb_ first appeared in SCOP 1.65
  
• d1oqwb_ appears in SCOPe 2.07