SCOP 1.71: Domain d1oqwa_: 1oqw A:

Lineage for d1oqwa_ (1oqw A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.24: Pili subunits [54522] (1 superfamily)
   contains very long N-terminal helix, which end is packed against beta-sheet

4. Superfamily d.24.1: Pili subunits [54523] (3 families)
   bacterial filament proteins

5. Family d.24.1.1: Pilin [54524] (4 proteins)

6. Protein Type IV Pilin Pak [109620] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [54527] (2 PDB entries)

8. Domain d1oqwa_: 1oqw A: [87323]

Details for d1oqwa_

PDB Entry: 1oqw, 2 Å

PDB Description: Full-Length PAK Pilin from Pseudomonas aeruginosa

SCOP Domain Sequences for d1oqwa_:

Sequence; same for both SEQRES and ATOM records:

>d1oqwa_ d.24.1.1 (A:) Type IV Pilin Pak {Pseudomonas aeruginosa}
ftlielmivvaiigilaaiaipqyqnyvarsegasalasvnplkttveealsrgwsvksg
tgtedatkkevplgvaadanklgtialkpdpadgtaditltftmggagpknkgkiitltr
taadglwkctsdqdeqfipkgcsr

Timeline for d1oqwa_:

• d1oqwa_ first appeared in SCOP 1.65
  
• d1oqwa_ appears in SCOP 1.69
  
• d1oqwa_ appears in SCOP 1.73
  
• d1oqwa_ appears in the current release, SCOPe 2.08