Lineage for d1oqva_ (1oqv A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2509472Fold d.24: Pili subunits [54522] (1 superfamily)
    contains very long N-terminal helix, which end is packed against beta-sheet
  4. 2509473Superfamily d.24.1: Pili subunits [54523] (8 families) (S)
    bacterial filament proteins
  5. 2509510Family d.24.1.2: TcpA-like pilin [89868] (1 protein)
    common fold is decorated with additional structures
  6. 2509511Protein Toxin-coregulated pilus subunit TcpA [89869] (1 species)
  7. 2509512Species Vibrio cholerae [TaxId:666] [89870] (2 PDB entries)
  8. 2509513Domain d1oqva_: 1oqv A: [87320]
    type IV pilin; classical biotype
    complexed with gol

Details for d1oqva_

PDB Entry: 1oqv (more details), 1.3 Å

PDB Description: Structure of TcpA, the Type IV pilin subunit from the toxin co-regulated pilus of Vibrio cholerae classical biotype
PDB Compounds: (A:) toxin-coregulated pilus subunit

SCOPe Domain Sequences for d1oqva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oqva_ d.24.1.2 (A:) Toxin-coregulated pilus subunit TcpA {Vibrio cholerae [TaxId: 666]}
dsqnmtkaaqslnsiqvaltqtyrglgnypatadataaskltsglvslgkissdeaknpf
igtnmnifsfprnaaankafaisvdgltqaqcktlitsvgdmfpyiaikaggavaladlg
dfensaaaaetgvgviksiapasknldltnithveklckgtapfgvafgns

SCOPe Domain Coordinates for d1oqva_:

Click to download the PDB-style file with coordinates for d1oqva_.
(The format of our PDB-style files is described here.)

Timeline for d1oqva_: