SCOP 1.67: Domain d1oqob1: 1oqo B:236-341

Lineage for d1oqob1 (1oqo B:236-341)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88585] (20 PDB entries)

8. Domain d1oqob1: 1oqo B:236-341 [87315]
   Other proteins in same PDB: d1oqoa2, d1oqob2, d1oqoc_, d1oqod_
   part of a Fc
   complexed with fuc, man, nag

Details for d1oqob1

PDB Entry: 1oqo, 2.3 Å

PDB Description: complex between g0 version of an fc bound to a minimized version of protein a called mini-z

SCOP Domain Sequences for d1oqob1:

Sequence; same for both SEQRES and ATOM records:

>d1oqob1 b.1.1.2 (B:236-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens)}
ggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeq
ynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakg

Timeline for d1oqob1:

• d1oqob1 first appeared in SCOP 1.65
  
• d1oqob1 appears in SCOP 1.69
  
• d1oqob1 appears in the current release, SCOPe 2.08