Lineage for d1oqmd_ (1oqm D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2505843Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2505844Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2505853Family c.68.1.2: beta 1,4 galactosyltransferase (b4GalT1) [53452] (2 proteins)
  6. 2505854Protein beta 1,4 galactosyltransferase (b4GalT1) [53453] (1 species)
  7. 2505855Species Cow (Bos taurus) [TaxId:9913] [53454] (30 PDB entries)
    Uniprot P08037 131-402
  8. 2505868Domain d1oqmd_: 1oqm D: [87312]
    Other proteins in same PDB: d1oqma_, d1oqmc_
    complexed with ca, mn, pg4, ud2

Details for d1oqmd_

PDB Entry: 1oqm (more details), 2.1 Å

PDB Description: A 1:1 complex between alpha-lactalbumin and beta1,4-galactosyltransferase in the presence of UDP-N-acetyl-galactosamine
PDB Compounds: (D:) beta-1,4-galactosyltransferase

SCOPe Domain Sequences for d1oqmd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oqmd_ c.68.1.2 (D:) beta 1,4 galactosyltransferase (b4GalT1) {Cow (Bos taurus) [TaxId: 9913]}
ltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdcisphkvaiiipfrn
rqehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgfkealkdydyncfvf
sdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsalskqqflsingfpnn
ywgwggedddiynrlafrgmsvsrpnavigkcrmirhsrdkknepnpqrfdriahtketm
lsdglnsltymvlevqryplytkitvdigtps

SCOPe Domain Coordinates for d1oqmd_:

Click to download the PDB-style file with coordinates for d1oqmd_.
(The format of our PDB-style files is described here.)

Timeline for d1oqmd_: