SCOPe 2.06: Domain d1oqmc_: 1oqm C:

Lineage for d1oqmc_ (1oqm C:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
   automatically mapped to Pfam PF00062

6. Protein alpha-Lactalbumin [53975] (6 species)
   expressed only in the lactating mammary gland, strongly binds calcium ion

7. Species Mouse (Mus musculus) [TaxId:10090] [69628] (14 PDB entries)

8. Domain d1oqmc_: 1oqm C: [87311]
   Other proteins in same PDB: d1oqmb_, d1oqmd_
   complexed with ca, mn, pg4, ud2

Details for d1oqmc_

PDB Entry: 1oqm, 2.1 Å

PDB Description: A 1:1 complex between alpha-lactalbumin and beta1,4-galactosyltransferase in the presence of UDP-N-acetyl-galactosamine

PDB Compounds: (C:) alpha-lactalbumin

SCOPe Domain Sequences for d1oqmc_:

Sequence; same for both SEQRES and ATOM records:

>d1oqmc_ d.2.1.2 (C:) alpha-Lactalbumin {Mouse (Mus musculus) [TaxId: 10090]}
teltkckvshaikdidgyqgisllewacvlfhtsgydtqavvndngsteyglfqisdrfw
ckssefpesenicgiscdkllddeldddiacakkilaikgidywkaykpmcsekleqwrc
ekp

Timeline for d1oqmc_:

• d1oqmc_ first appeared in SCOP 1.65
  
• d1oqmc_ appears in SCOPe 2.05
  
• d1oqmc_ appears in SCOPe 2.07
  
• d1oqmc_ appears in the current release, SCOPe 2.08