| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) ![]() |
| Family d.2.1.2: C-type lysozyme [53960] (3 proteins) automatically mapped to Pfam PF00062 |
| Protein alpha-Lactalbumin [53975] (6 species) expressed only in the lactating mammary gland, strongly binds calcium ion |
| Species Mouse (Mus musculus) [TaxId:10090] [69628] (14 PDB entries) |
| Domain d1oqma_: 1oqm A: [87309] Other proteins in same PDB: d1oqmb_, d1oqmd_ complexed with ca, mn, pg4, ud2 |
PDB Entry: 1oqm (more details), 2.1 Å
SCOPe Domain Sequences for d1oqma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oqma_ d.2.1.2 (A:) alpha-Lactalbumin {Mouse (Mus musculus) [TaxId: 10090]}
teltkckvshaikdidgyqgisllewacvlfhtsgydtqavvndngsteyglfqisdrfw
ckssefpesenicgiscdkllddeldddiacakkilaikgidywkaykpmcsekleqwrc
ekp
Timeline for d1oqma_: