Lineage for d1oqma_ (1oqm A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1887016Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1887017Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1887055Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
    automatically mapped to Pfam PF00062
  6. 1887056Protein alpha-Lactalbumin [53975] (6 species)
    expressed only in the lactating mammary gland, strongly binds calcium ion
  7. 1887088Species Mouse (Mus musculus) [TaxId:10090] [69628] (12 PDB entries)
  8. 1887103Domain d1oqma_: 1oqm A: [87309]
    Other proteins in same PDB: d1oqmb_, d1oqmd_
    complexed with ca, mn, pg4, ud2

Details for d1oqma_

PDB Entry: 1oqm (more details), 2.1 Å

PDB Description: A 1:1 complex between alpha-lactalbumin and beta1,4-galactosyltransferase in the presence of UDP-N-acetyl-galactosamine
PDB Compounds: (A:) alpha-lactalbumin

SCOPe Domain Sequences for d1oqma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oqma_ d.2.1.2 (A:) alpha-Lactalbumin {Mouse (Mus musculus) [TaxId: 10090]}
teltkckvshaikdidgyqgisllewacvlfhtsgydtqavvndngsteyglfqisdrfw
ckssefpesenicgiscdkllddeldddiacakkilaikgidywkaykpmcsekleqwrc
ekp

SCOPe Domain Coordinates for d1oqma_:

Click to download the PDB-style file with coordinates for d1oqma_.
(The format of our PDB-style files is described here.)

Timeline for d1oqma_: