Lineage for d1oqlb1 (1oql B:1-137)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1790651Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1791069Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 1791070Family b.42.2.1: Ricin B-like [50371] (11 proteins)
  6. 1791152Protein Plant cytotoxin B-chain (lectin) [50372] (5 species)
    duplication: consists of two domains of this fold
  7. 1791165Species European mistletoe (Viscum album) [TaxId:3972] [50375] (12 PDB entries)
    different sequence variants
    Uniprot Q6ITZ3 266-520; Uniprot P81446 269-531 # 91% sequence identity
  8. 1791178Domain d1oqlb1: 1oql B:1-137 [87307]
    Other proteins in same PDB: d1oqla_
    complexed with gal, nag

Details for d1oqlb1

PDB Entry: 1oql (more details), 3 Å

PDB Description: mistletoe lectin i from viscum album complexed with galactose
PDB Compounds: (B:) mistletoe lectin I

SCOPe Domain Sequences for d1oqlb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oqlb1 b.42.2.1 (B:1-137) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]}
ddvtcsaseptvrivgrngmcvdvrdddfrdgnqiqlwpsksnndpnqlwtikrdgtirs
ngsclttygytagvyvmifdcntavreatlwqiwgngtiinprsnlvlaassgikgttlt
vqtldytlgqgwlagnd

SCOPe Domain Coordinates for d1oqlb1:

Click to download the PDB-style file with coordinates for d1oqlb1.
(The format of our PDB-style files is described here.)

Timeline for d1oqlb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1oqlb2
View in 3D
Domains from other chains:
(mouse over for more information)
d1oqla_