SCOP 1.73: Domain d1oqha_: 1oqh A:

Lineage for d1oqha_ (1oqh A:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.2: Transferrin [53888] (3 proteins)
   further duplication: composed of two two-domain lobes

6. Protein Transferrin [53897] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53899] (17 PDB entries)

8. Domain d1oqha_: 1oqh A: [87305]
   N-terminal lobe
   complexed with co3, fe, k; mutant

Details for d1oqha_

PDB Entry: 1oqh, 2.4 Å

PDB Description: crystal structure of the r124a mutant of the n-lobe human transferrin

PDB Compounds: (A:) serotransferrin

SCOP Domain Sequences for d1oqha_:

Sequence; same for both SEQRES and ATOM records:

>d1oqha_ c.94.1.2 (A:) Transferrin {Human (Homo sapiens) [TaxId: 9606]}
dktvrwcavseheatkcqsfrdhmksvipsdgpsvacvkkasyldciraiaaneadavtl
daglvydaylapnnlkpvvaefygskedpqtfyyavavvkkdsgfqmnqlrgkkschtgl
gasagwnipigllycdlpeprkplekavanffsgscapcadgtdfpqlcqlcpgcgcstl
nqyfgysgafkclkdgagdvafvkhstifenlankadrdqyellcldntrkpvdeykdch
laqvpshtvvarsmggkedliwellnqaqehfgkdkskefqlfssphgkdllfkdsahgf
lkvpprmdakmylgyeyvtairnlregtc

Timeline for d1oqha_:

• d1oqha_ first appeared in SCOP 1.65
  
• d1oqha_ appears in SCOP 1.71
  
• d1oqha_ appears in SCOP 1.75
  
• d1oqha_ appears in the current release, SCOPe 2.08