![]() | Class g: Small proteins [56992] (85 folds) |
![]() | Fold g.24: TNF receptor-like [57585] (1 superfamily) duplication: consists of three similar disulfide-rich domains |
![]() | Superfamily g.24.1: TNF receptor-like [57586] (2 families) ![]() |
![]() | Family g.24.1.2: BAFF receptor-like [90174] (3 proteins) only fragments of the receptor structures are available; no domain division is provided here |
![]() | Protein Tumor necrosis factor receptor superfamily member 17, BCMA [90177] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [90178] (2 PDB entries) |
![]() | Domain d1oqdq_: 1oqd Q: [87284] Other proteins in same PDB: d1oqda_, d1oqdb_, d1oqdc_, d1oqdd_, d1oqde_, d1oqdf_, d1oqdg_, d1oqdh_, d1oqdi_, d1oqdj_ |
PDB Entry: 1oqd (more details), 2.6 Å
SCOP Domain Sequences for d1oqdq_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oqdq_ g.24.1.2 (Q:) Tumor necrosis factor receptor superfamily member 17, BCMA {Human (Homo sapiens) [TaxId: 9606]} csqneyfdsllhacipcqlrcssntppltcqrycnasvt
Timeline for d1oqdq_: