Lineage for d1oqdo_ (1oqd O:)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 749631Fold g.24: TNF receptor-like [57585] (1 superfamily)
    duplication: consists of three similar disulfide-rich domains
  4. 749632Superfamily g.24.1: TNF receptor-like [57586] (2 families) (S)
  5. 749723Family g.24.1.2: BAFF receptor-like [90174] (3 proteins)
    only fragments of the receptor structures are available; no domain division is provided here
  6. 749741Protein Tumor necrosis factor receptor superfamily member 17, BCMA [90177] (1 species)
  7. 749742Species Human (Homo sapiens) [TaxId:9606] [90178] (2 PDB entries)
  8. 749750Domain d1oqdo_: 1oqd O: [87282]
    Other proteins in same PDB: d1oqda_, d1oqdb_, d1oqdc_, d1oqdd_, d1oqde_, d1oqdf_, d1oqdg_, d1oqdh_, d1oqdi_, d1oqdj_

Details for d1oqdo_

PDB Entry: 1oqd (more details), 2.6 Å

PDB Description: Crystal structure of sTALL-1 and BCMA
PDB Compounds: (O:) Tumor necrosis factor receptor superfamily member 17

SCOP Domain Sequences for d1oqdo_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oqdo_ g.24.1.2 (O:) Tumor necrosis factor receptor superfamily member 17, BCMA {Human (Homo sapiens) [TaxId: 9606]}
csqneyfdsllhacipcqlrcssntppltcqrycnasvt

SCOP Domain Coordinates for d1oqdo_:

Click to download the PDB-style file with coordinates for d1oqdo_.
(The format of our PDB-style files is described here.)

Timeline for d1oqdo_: