Lineage for d1oqdk_ (1oqd K:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2639372Fold g.24: TNF receptor-like [57585] (1 superfamily)
    duplication: consists of three similar disulfide-rich domains
  4. 2639373Superfamily g.24.1: TNF receptor-like [57586] (3 families) (S)
  5. 2639499Family g.24.1.2: BAFF receptor-like [90174] (4 proteins)
    only fragments of the receptor structures are available; no domain division is provided here
  6. 2639517Protein Tumor necrosis factor receptor superfamily member 17, BCMA [90177] (1 species)
  7. 2639518Species Human (Homo sapiens) [TaxId:9606] [90178] (3 PDB entries)
    Uniprot Q02223 8-43
  8. 2639524Domain d1oqdk_: 1oqd K: [87278]
    Other proteins in same PDB: d1oqda_, d1oqdb_, d1oqdc_, d1oqdd_, d1oqde_, d1oqdf_, d1oqdg_, d1oqdh_, d1oqdi_, d1oqdj_

Details for d1oqdk_

PDB Entry: 1oqd (more details), 2.6 Å

PDB Description: Crystal structure of sTALL-1 and BCMA
PDB Compounds: (K:) Tumor necrosis factor receptor superfamily member 17

SCOPe Domain Sequences for d1oqdk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oqdk_ g.24.1.2 (K:) Tumor necrosis factor receptor superfamily member 17, BCMA {Human (Homo sapiens) [TaxId: 9606]}
csqneyfdsllhacipcqlrcssntppltcqrycnasvt

SCOPe Domain Coordinates for d1oqdk_:

Click to download the PDB-style file with coordinates for d1oqdk_.
(The format of our PDB-style files is described here.)

Timeline for d1oqdk_: