SCOPe 2.05: Domain d1oqcb_: 1oqc B:

Lineage for d1oqcb_ (1oqc B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.15: FAD-dependent thiol oxidase [69000] (2 families)

5. Family a.24.15.1: FAD-dependent thiol oxidase [69001] (3 proteins)

6. Protein Augmenter of liver regeneration [89018] (2 species)
   a mammalian FAD-dependent sulfhydryl oxidase

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [89019] (1 PDB entry)

8. Domain d1oqcb_: 1oqc B: [87265]
   complexed with fad

Details for d1oqcb_

PDB Entry: 1oqc, 1.8 Å

PDB Description: The crystal structure of augmenter of liver regeneration: a mammalian FAD dependent sulfhydryl oxidase

PDB Compounds: (B:) Augmenter of liver regeneration

SCOPe Domain Sequences for d1oqcb_:

Sequence; same for both SEQRES and ATOM records:

>d1oqcb_ a.24.15.1 (B:) Augmenter of liver regeneration {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dcpqdreelgrntwaflhtlaayypdmptpeqqqdmaqfihifskfypceecaedirkri
drsqpdtstrvsfsqwlcrlhnevnrklgkpdfdcsrvderwrdgwkdgsc

Timeline for d1oqcb_:

• d1oqcb_ first appeared in SCOP 1.65
  
• d1oqcb_ appears in SCOPe 2.04
  
• d1oqcb_ appears in SCOPe 2.06
  
• d1oqcb_ appears in the current release, SCOPe 2.08