Class a: All alpha proteins [46456] (258 folds) |
Fold a.25: Ferritin-like [47239] (4 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (5 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.2: Ribonucleotide reductase-like [47253] (8 proteins) |
Protein delta 9-stearoyl-acyl carrier protein desaturase [47261] (1 species) |
Species Castor bean (Ricinus communis) [TaxId:3988] [47262] (5 PDB entries) |
Domain d1oqbf_: 1oqb F: [87263] complexed with fe2 |
PDB Entry: 1oqb (more details), 2.8 Å
SCOP Domain Sequences for d1oqbf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oqbf_ a.25.1.2 (F:) delta 9-stearoyl-acyl carrier protein desaturase {Castor bean (Ricinus communis) [TaxId: 3988]} fmpprevhvqvthsmppqkieifksldnwaeenilvhlkpvekcwqpqdflpdpasdgfd eqvrelrerakeipddyfvvlvgdmiteealptyqtmlntldgvrdetgasptswaiwtr awtaeenrhgdllnkylylsgrvdmrqiektiqyligsgmdprtenspylgfiytsfqer atfishgntarqakehgdiklaqicgtiaadekrhetaytkiveklfeidpdgtvlafad mmrkkismpahlmydgrddnlfdhfsavaqrlgvytakdyadileflvgrwkvdkltgls aegqkaqdyvcrlpprirrleeraqgrakeaptmpfswifdrqvkl
Timeline for d1oqbf_: