Lineage for d1oq7a_ (1oq7 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988413Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1988414Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1990025Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 protein domains)
  6. 1990026Protein delta 9-stearoyl-acyl carrier protein desaturase [47261] (1 species)
  7. 1990027Species Castor bean (Ricinus communis) [TaxId:3988] [47262] (5 PDB entries)
  8. 1990047Domain d1oq7a_: 1oq7 A: [87251]
    complexed with sr

Details for d1oq7a_

PDB Entry: 1oq7 (more details), 3.2 Å

PDB Description: The crystal structure of the iron free (Apo-)form of Stearoyl Acyl Carrier Protein Desaturase from Ricinus Communis (Castor Bean).
PDB Compounds: (A:) Acyl-[acyl-carrier protein] desaturase

SCOPe Domain Sequences for d1oq7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oq7a_ a.25.1.2 (A:) delta 9-stearoyl-acyl carrier protein desaturase {Castor bean (Ricinus communis) [TaxId: 3988]}
fmpprevhvqvthsmppqkieifksldnwaeenilvhlkpvekcwqpqdflpdpasdgfd
eqvrelrerakeipddyfvvlvgdmiteealptyqtmlntldgvrdetgasptswaiwtr
awtaeenrhgdllnkylylsgrvdmrqiektiqyligsgmdprtenspylgfiytsfqer
atfishgntarqakehgdiklaqicgtiaadekrhetaytkiveklfeidpdgtvlafad
mmrkkismpahlmydgrddnlfdhfsavaqrlgvytakdyadileflvgrwkvdkltgls
aegqkaqdyvcrlpprirrleeraqgrakeaptmpfswifdrqvkl

SCOPe Domain Coordinates for d1oq7a_:

Click to download the PDB-style file with coordinates for d1oq7a_.
(The format of our PDB-style files is described here.)

Timeline for d1oq7a_: