SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1oq4d_ (1oq4 D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988413Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1988414Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1990025Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 protein domains)
  6. 1990026Protein delta 9-stearoyl-acyl carrier protein desaturase [47261] (1 species)
  7. 1990027Species Castor bean (Ricinus communis) [TaxId:3988] [47262] (5 PDB entries)
  8. 1990038Domain d1oq4d_: 1oq4 D: [87248]
    complexed with azi, fe

Details for d1oq4d_

PDB Entry: 1oq4 (more details), 2.4 Å

PDB Description: The Crystal Structure of the Complex between Stearoyl Acyl Carrier Protein Desaturase from Ricinus Communis (Castor Bean) and Azide.
PDB Compounds: (D:) Acyl-[acyl-carrier protein] desaturase

SCOPe Domain Sequences for d1oq4d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oq4d_ a.25.1.2 (D:) delta 9-stearoyl-acyl carrier protein desaturase {Castor bean (Ricinus communis) [TaxId: 3988]}
fmpprevhvqvthsmppqkieifksldnwaeenilvhlkpvekcwqpqdflpdpasdgfd
eqvrelrerakeipddyfvvlvgdmiteealptyqtmlntldgvrdetgasptswaiwtr
awtaeenrhgdllnkylylsgrvdmrqiektiqyligsgmdprtenspylgfiytsfqer
atfishgntarqakehgdiklaqicgtiaadekrhetaytkiveklfeidpdgtvlafad
mmrkkismpahlmydgrddnlfdhfsavaqrlgvytakdyadileflvgrwkvdkltgls
aegqkaqdyvcrlpprirrleeraqgrakeaptmpfswifdrqvkl

SCOPe Domain Coordinates for d1oq4d_:

Click to download the PDB-style file with coordinates for d1oq4d_.
(The format of our PDB-style files is described here.)

Timeline for d1oq4d_: