Lineage for d1oq4d_ (1oq4 D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988413Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1988414Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1990025Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 protein domains)
  6. 1990026Protein delta 9-stearoyl-acyl carrier protein desaturase [47261] (1 species)
  7. 1990027Species Castor bean (Ricinus communis) [TaxId:3988] [47262] (5 PDB entries)
  8. 1990038Domain d1oq4d_: 1oq4 D: [87248]
    complexed with azi, fe

Details for d1oq4d_

PDB Entry: 1oq4 (more details), 2.4 Å

PDB Description: The Crystal Structure of the Complex between Stearoyl Acyl Carrier Protein Desaturase from Ricinus Communis (Castor Bean) and Azide.
PDB Compounds: (D:) Acyl-[acyl-carrier protein] desaturase

SCOPe Domain Sequences for d1oq4d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oq4d_ a.25.1.2 (D:) delta 9-stearoyl-acyl carrier protein desaturase {Castor bean (Ricinus communis) [TaxId: 3988]}
fmpprevhvqvthsmppqkieifksldnwaeenilvhlkpvekcwqpqdflpdpasdgfd
eqvrelrerakeipddyfvvlvgdmiteealptyqtmlntldgvrdetgasptswaiwtr
awtaeenrhgdllnkylylsgrvdmrqiektiqyligsgmdprtenspylgfiytsfqer
atfishgntarqakehgdiklaqicgtiaadekrhetaytkiveklfeidpdgtvlafad
mmrkkismpahlmydgrddnlfdhfsavaqrlgvytakdyadileflvgrwkvdkltgls
aegqkaqdyvcrlpprirrleeraqgrakeaptmpfswifdrqvkl

SCOPe Domain Coordinates for d1oq4d_:

Click to download the PDB-style file with coordinates for d1oq4d_.
(The format of our PDB-style files is described here.)

Timeline for d1oq4d_: