Lineage for d1oplb2 (1opl B:252-518)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2218179Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2218209Protein Abelsone tyrosine kinase (abl) [56166] (2 species)
    PTK group; Abl subfamily; non-membrane spanning protein tyrosine kinase
  7. 2218223Species Mouse (Mus musculus) [TaxId:10090] [56167] (7 PDB entries)
  8. 2218235Domain d1oplb2: 1opl B:252-518 [87239]
    Other proteins in same PDB: d1opla1, d1opla2, d1oplb1
    complexed with myr, p16

Details for d1oplb2

PDB Entry: 1opl (more details), 3.42 Å

PDB Description: structural basis for the auto-inhibition of c-abl tyrosine kinase
PDB Compounds: (B:) proto-oncogene tyrosine-protein kinase

SCOPe Domain Sequences for d1oplb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oplb2 d.144.1.7 (B:252-518) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]}
dkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkeaavmke
ikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvllymatqissame
ylekknfihrnlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapesla
ynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyelm
racwqwnpsdrpsfaeihqafetmfqe

SCOPe Domain Coordinates for d1oplb2:

Click to download the PDB-style file with coordinates for d1oplb2.
(The format of our PDB-style files is described here.)

Timeline for d1oplb2: