Lineage for d1oplb1 (1opl B:140-237)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 729699Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices
  4. 729700Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 729701Family d.93.1.1: SH2 domain [55551] (32 proteins)
    Pfam PF00017
  6. 729702Protein Abl tyrosine kinase [55581] (2 species)
  7. 729705Species Mouse (Mus musculus) [TaxId:10090] [89998] (2 PDB entries)
  8. 729708Domain d1oplb1: 1opl B:140-237 [87238]
    Other proteins in same PDB: d1opla1, d1opla3, d1oplb2
    complexed with myr, p16; mutant

Details for d1oplb1

PDB Entry: 1opl (more details), 3.42 Å

PDB Description: Structural basis for the auto-inhibition of c-Abl tyrosine kinase
PDB Compounds: (B:) proto-oncogene tyrosine-protein kinase

SCOP Domain Sequences for d1oplb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oplb1 d.93.1.1 (B:140-237) Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]}
slekhswyhgpvsrnaaeyllssgingsflvresesspgqrsislryegrvyhyrintas
dgklyvssesrfntlaelvhhhstvadglittlhypap

SCOP Domain Coordinates for d1oplb1:

Click to download the PDB-style file with coordinates for d1oplb1.
(The format of our PDB-style files is described here.)

Timeline for d1oplb1: