SCOPe 2.06: Domain d1opla3: 1opl A:241-531

Lineage for d1opla3 (1opl A:241-531)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Abelsone tyrosine kinase (abl) [56166] (2 species)
   PTK group; Abl subfamily; non-membrane spanning protein tyrosine kinase

7. Species Mouse (Mus musculus) [TaxId:10090] [56167] (7 PDB entries)

8. Domain d1opla3: 1opl A:241-531 [87237]
   Other proteins in same PDB: d1opla1, d1opla2, d1oplb1
   complexed with myr, p16

Details for d1opla3

PDB Entry: 1opl, 3.42 Å

PDB Description: structural basis for the auto-inhibition of c-abl tyrosine kinase

PDB Compounds: (A:) proto-oncogene tyrosine-protein kinase

SCOPe Domain Sequences for d1opla3:

Sequence; same for both SEQRES and ATOM records:

>d1opla3 d.144.1.7 (A:241-531) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]}
kptvygvspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeve
eflkeaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvll
ymatqissameylekknfihrnlaarnclvgenhlvkvadfglsrlmtgdtytahagakf
pikwtapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerp
egcpekvyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelgk

Timeline for d1opla3:

• d1opla3 first appeared in SCOP 1.65
  
• d1opla3 appears in SCOPe 2.05
  
• d1opla3 appears in SCOPe 2.07
  
• d1opla3 appears in the current release, SCOPe 2.08