![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (18 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.2: SH3-domain [50044] (1 family) ![]() |
![]() | Family b.34.2.1: SH3-domain [50045] (38 proteins) |
![]() | Protein Abl tyrosine kinase, SH3 domain [50052] (2 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [50053] (4 PDB entries) |
![]() | Domain d1opla1: 1opl A:81-139 [87235] Other proteins in same PDB: d1opla2, d1opla3, d1oplb1, d1oplb2 complexed with myr, p16; mutant |
PDB Entry: 1opl (more details), 3.42 Å
SCOP Domain Sequences for d1opla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1opla1 b.34.2.1 (A:81-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} dpnlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitpvn
Timeline for d1opla1: