Lineage for d1opla1 (1opl A:81-139)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 665027Fold b.34: SH3-like barrel [50036] (18 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 665103Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 665104Family b.34.2.1: SH3-domain [50045] (38 proteins)
  6. 665108Protein Abl tyrosine kinase, SH3 domain [50052] (2 species)
  7. 665118Species Mouse (Mus musculus) [TaxId:10090] [50053] (4 PDB entries)
  8. 665123Domain d1opla1: 1opl A:81-139 [87235]
    Other proteins in same PDB: d1opla2, d1opla3, d1oplb1, d1oplb2
    complexed with myr, p16; mutant

Details for d1opla1

PDB Entry: 1opl (more details), 3.42 Å

PDB Description: Structural basis for the auto-inhibition of c-Abl tyrosine kinase
PDB Compounds: (A:) proto-oncogene tyrosine-protein kinase

SCOP Domain Sequences for d1opla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1opla1 b.34.2.1 (A:81-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]}
dpnlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitpvn

SCOP Domain Coordinates for d1opla1:

Click to download the PDB-style file with coordinates for d1opla1.
(The format of our PDB-style files is described here.)

Timeline for d1opla1: