SCOP 1.71: Domain d1opka3: 1opk A:241-531

Lineage for d1opka3 (1opk A:241-531)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (60 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Abelsone tyrosine kinase (abl) [56166] (1 species)
   PTK group; Abl subfamily; non-membrane spanning protein tyrosine kinase

7. Species Mouse (Mus musculus) [TaxId:10090] [56167] (6 PDB entries)

8. Domain d1opka3: 1opk A:241-531 [87234]
   Other proteins in same PDB: d1opka1, d1opka2
   complexed with gol, myr, p16; mutant

Details for d1opka3

PDB Entry: 1opk, 1.8 Å

PDB Description: structural basis for the auto-inhibition of c-abl tyrosine kinase

SCOP Domain Sequences for d1opka3:

Sequence; same for both SEQRES and ATOM records:

>d1opka3 d.144.1.7 (A:241-531) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus)}
kptiygvspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeve
eflkeaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvll
ymatqissameylekknfihrnlaarnclvgenhlvkvadfglsrlmtgdtytahagakf
pikwtapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerp
egcpekvyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelgk

Timeline for d1opka3:

• d1opka3 first appeared in SCOP 1.65
  
• d1opka3 appears in SCOP 1.69
  
• d1opka3 appears in SCOP 1.73
  
• d1opka3 appears in the current release, SCOPe 2.08