![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein Abelsone tyrosine kinase (abl) [56166] (2 species) PTK group; Abl subfamily; non-membrane spanning protein tyrosine kinase |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [56167] (16 PDB entries) |
![]() | Domain d1opka3: 1opk A:241-531 [87234] Other proteins in same PDB: d1opka1, d1opka2 complexed with gol, myr, p16 |
PDB Entry: 1opk (more details), 1.8 Å
SCOPe Domain Sequences for d1opka3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1opka3 d.144.1.7 (A:241-531) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} kptiygvspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeve eflkeaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvll ymatqissameylekknfihrnlaarnclvgenhlvkvadfglsrlmtgdtytahagakf pikwtapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerp egcpekvyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelgk
Timeline for d1opka3: