SCOPe 2.06: Domain d1opka2: 1opk A:140-240

Lineage for d1opka2 (1opk A:140-240)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
   Pfam PF00017

6. Protein Abl tyrosine kinase [55581] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [89998] (1 PDB entry)

8. Domain d1opka2: 1opk A:140-240 [87233]
   Other proteins in same PDB: d1opka1, d1opka3
   complexed with gol, myr, p16

Details for d1opka2

PDB Entry: 1opk, 1.8 Å

PDB Description: structural basis for the auto-inhibition of c-abl tyrosine kinase

PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase ABL1

SCOPe Domain Sequences for d1opka2:

Sequence; same for both SEQRES and ATOM records:

>d1opka2 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]}
slekhswyhgpvsrnaaeyllssgingsflvresesspgqrsislryegrvyhyrintas
dgklyvssesrfntlaelvhhhstvadglittlhypapkrn

Timeline for d1opka2:

• d1opka2 first appeared in SCOP 1.65
  
• d1opka2 appears in SCOPe 2.05
  
• d1opka2 appears in SCOPe 2.07
  
• d1opka2 appears in the current release, SCOPe 2.08