Lineage for d1opka2 (1opk A:140-240)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 729699Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices
  4. 729700Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 729701Family d.93.1.1: SH2 domain [55551] (32 proteins)
    Pfam PF00017
  6. 729702Protein Abl tyrosine kinase [55581] (2 species)
  7. 729705Species Mouse (Mus musculus) [TaxId:10090] [89998] (2 PDB entries)
  8. 729706Domain d1opka2: 1opk A:140-240 [87233]
    Other proteins in same PDB: d1opka1, d1opka3
    complexed with gol, myr, p16; mutant

Details for d1opka2

PDB Entry: 1opk (more details), 1.8 Å

PDB Description: Structural basis for the auto-inhibition of c-Abl tyrosine kinase
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase ABL1

SCOP Domain Sequences for d1opka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1opka2 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]}
slekhswyhgpvsrnaaeyllssgingsflvresesspgqrsislryegrvyhyrintas
dgklyvssesrfntlaelvhhhstvadglittlhypapkrn

SCOP Domain Coordinates for d1opka2:

Click to download the PDB-style file with coordinates for d1opka2.
(The format of our PDB-style files is described here.)

Timeline for d1opka2: