Lineage for d1opka2 (1opk A:140-240)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 332255Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices
  4. 332256Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 332257Family d.93.1.1: SH2 domain [55551] (25 proteins)
  6. 332258Protein Abl tyrosine kinase [55581] (2 species)
  7. 332261Species Mouse (Mus musculus) [TaxId:10090] [89998] (2 PDB entries)
  8. 332262Domain d1opka2: 1opk A:140-240 [87233]
    Other proteins in same PDB: d1opka1, d1opka3
    complexed with gol, myr, p16; mutant

Details for d1opka2

PDB Entry: 1opk (more details), 1.8 Å

PDB Description: structural basis for the auto-inhibition of c-abl tyrosine kinase

SCOP Domain Sequences for d1opka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1opka2 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (Mus musculus)}
slekhswyhgpvsrnaaeyllssgingsflvresesspgqrsislryegrvyhyrintas
dgklyvssesrfntlaelvhhhstvadglittlhypapkrn

SCOP Domain Coordinates for d1opka2:

Click to download the PDB-style file with coordinates for d1opka2.
(The format of our PDB-style files is described here.)

Timeline for d1opka2: