Class b: All beta proteins [48724] (178 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.1: SH3-domain [50045] (40 proteins) |
Protein Abl tyrosine kinase, SH3 domain [50052] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [50053] (3 PDB entries) |
Domain d1opka1: 1opk A:83-139 [87232] Other proteins in same PDB: d1opka2, d1opka3 complexed with gol, myr, p16 |
PDB Entry: 1opk (more details), 1.8 Å
SCOPe Domain Sequences for d1opka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} nlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitpvn
Timeline for d1opka1: