Lineage for d1opka1 (1opk A:83-139)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2392486Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2392487Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2392491Protein Abl tyrosine kinase, SH3 domain [50052] (2 species)
  7. 2392502Species Mouse (Mus musculus) [TaxId:10090] [50053] (3 PDB entries)
  8. 2392503Domain d1opka1: 1opk A:83-139 [87232]
    Other proteins in same PDB: d1opka2, d1opka3
    complexed with gol, myr, p16

Details for d1opka1

PDB Entry: 1opk (more details), 1.8 Å

PDB Description: structural basis for the auto-inhibition of c-abl tyrosine kinase
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase ABL1

SCOPe Domain Sequences for d1opka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]}
nlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitpvn

SCOPe Domain Coordinates for d1opka1:

Click to download the PDB-style file with coordinates for d1opka1.
(The format of our PDB-style files is described here.)

Timeline for d1opka1: