SCOPe 2.06: Domain d1opka1: 1opk A:83-139

Lineage for d1opka1 (1opk A:83-139)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein Abl tyrosine kinase, SH3 domain [50052] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [50053] (3 PDB entries)

8. Domain d1opka1: 1opk A:83-139 [87232]
   Other proteins in same PDB: d1opka2, d1opka3
   complexed with gol, myr, p16

Details for d1opka1

PDB Entry: 1opk, 1.8 Å

PDB Description: structural basis for the auto-inhibition of c-abl tyrosine kinase

PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase ABL1

SCOPe Domain Sequences for d1opka1:

Sequence; same for both SEQRES and ATOM records:

>d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]}
nlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitpvn

Timeline for d1opka1:

• d1opka1 first appeared in SCOP 1.65
  
• d1opka1 appears in SCOPe 2.05
  
• d1opka1 appears in SCOPe 2.07
  
• d1opka1 appears in the current release, SCOPe 2.08