Lineage for d1opjb_ (1opj B:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
consists of two alpha+beta domains, C-terminal domain is mostly alpha helicalSuperfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) 
shares functional and structural similarities with the ATP-grasp fold and PIPK
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
members organized in the groups and subfamiles specified by the comments
Protein Abelsone tyrosine kinase (abl) [56166] (2 species)
PTK group; Abl subfamily; non-membrane spanning protein tyrosine kinase- Species Mouse (Mus musculus) [TaxId:10090] [56167] (7 PDB entries)
Domain d1opjb_: 1opj B: [87231]
complexed with cl, myr, sti
Details for d1opjb_
PDB Entry: 1opj (more details), 1.75 Å
PDB Description: Structural basis for the auto-inhibition of c-Abl tyrosine kinase
PDB Compounds: (B:) Proto-oncogene tyrosine-protein kinase ABL1SCOPe Domain Sequences for d1opjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1opjb_ d.144.1.7 (B:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]}
mdpsspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveefl
keaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllyma
tqissameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpik
wtapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegc
pekvyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelgk
SCOPe Domain Coordinates for d1opjb_:
Click to download the PDB-style file with coordinates for d1opjb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1opjb_:
- d1opjb_ first appeared in SCOP 1.65
- d1opjb_ appears in SCOPe 2.04
- d1opjb_ is called d1opjb1 in SCOPe 2.06
- d1opjb_ appears in the current release, SCOPe 2.08, called d1opjb1
View in 3D
