![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein Abelsone tyrosine kinase (abl) [56166] (1 species) PTK group; Abl subfamily; non-membrane spanning protein tyrosine kinase |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [56167] (8 PDB entries) |
![]() | Domain d1opjb_: 1opj B: [87231] complexed with cl, myr, sti |
PDB Entry: 1opj (more details), 1.75 Å
SCOP Domain Sequences for d1opjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1opjb_ d.144.1.7 (B:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} mdpsspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveefl keaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllyma tqissameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpik wtapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegc pekvyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelgk
Timeline for d1opjb_: