Lineage for d1op8e_ (1op8 E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794859Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2795599Protein Granzyme A [89345] (1 species)
  7. 2795600Species Human (Homo sapiens) [TaxId:9606] [89346] (2 PDB entries)
  8. 2795606Domain d1op8e_: 1op8 E: [87228]
    complexed with so4

Details for d1op8e_

PDB Entry: 1op8 (more details), 2.5 Å

PDB Description: Crystal Structure of Human Granzyme A
PDB Compounds: (E:) Granzyme A

SCOPe Domain Sequences for d1op8e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1op8e_ b.47.1.2 (E:) Granzyme A {Human (Homo sapiens) [TaxId: 9606]}
iiggnevtphsrpymvllsldrkticagaliakdwvltaahcnlnkrsqvilgahsitre
eptkqimlvkkefpypcydpatregdlkllqltekakinkyvtilhlpkkgddvkpgtmc
qvagwgrthnsaswsdtlrevnitiidrkvcndrnhynfnpvigmnmvcagslrggrdsc
ngdsgspllcegvfrgvtsfglenkcgdprgpgvyillskkhlnwiimtikgav

SCOPe Domain Coordinates for d1op8e_:

Click to download the PDB-style file with coordinates for d1op8e_.
(The format of our PDB-style files is described here.)

Timeline for d1op8e_: