|  | Class b: All beta proteins [48724] (141 folds) | 
|  | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold | 
|  | Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)  | 
|  | Family b.47.1.2: Eukaryotic proteases [50514] (44 proteins) | 
|  | Protein Granzyme A [89345] (1 species) | 
|  | Species Human (Homo sapiens) [TaxId:9606] [89346] (2 PDB entries) | 
|  | Domain d1op8c_: 1op8 C: [87226] | 
PDB Entry: 1op8 (more details), 2.5 Å
SCOP Domain Sequences for d1op8c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1op8c_ b.47.1.2 (C:) Granzyme A {Human (Homo sapiens)}
iiggnevtphsrpymvllsldrkticagaliakdwvltaahcnlnkrsqvilgahsitre
eptkqimlvkkefpypcydpatregdlkllqltekakinkyvtilhlpkkgddvkpgtmc
qvagwgrthnsaswsdtlrevnitiidrkvcndrnhynfnpvigmnmvcagslrggrdsc
ngdsgspllcegvfrgvtsfglenkcgdprgpgvyillskkhlnwiimtikgav
Timeline for d1op8c_: