Lineage for d1op5m2 (1op5 M:116-229)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 289100Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 289104Species Human (Homo sapiens) [TaxId:9606] [88575] (63 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 289183Domain d1op5m2: 1op5 M:116-229 [87223]
    Other proteins in same PDB: d1op5h1, d1op5k1, d1op5k2, d1op5l1, d1op5l2, d1op5m1
    part of Fab 2G12
    complexed with man, nag

Details for d1op5m2

PDB Entry: 1op5 (more details), 3 Å

PDB Description: crystal structure of fab 2g12 bound to man9glcnac2

SCOP Domain Sequences for d1op5m2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1op5m2 b.1.1.2 (M:116-229) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
tkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgl
yslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks

SCOP Domain Coordinates for d1op5m2:

Click to download the PDB-style file with coordinates for d1op5m2.
(The format of our PDB-style files is described here.)

Timeline for d1op5m2: