SCOP 1.67: Domain d1op5h2: 1op5 H:116-229

Lineage for d1op5h2 (1op5 H:116-229)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (78 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d1op5h2: 1op5 H:116-229 [87217]
   Other proteins in same PDB: d1op5h1, d1op5k1, d1op5k2, d1op5l1, d1op5l2, d1op5m1

Details for d1op5h2

PDB Entry: 1op5, 3 Å

PDB Description: crystal structure of fab 2g12 bound to man9glcnac2

SCOP Domain Sequences for d1op5h2:

Sequence; same for both SEQRES and ATOM records:

>d1op5h2 b.1.1.2 (H:116-229) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
tkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgl
yslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks

Timeline for d1op5h2:

• d1op5h2 first appeared in SCOP 1.65
  
• d1op5h2 appears in SCOP 1.69
  
• d1op5h2 last appears in SCOPe 2.07