Class b: All beta proteins [48724] (126 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
Species Human (Homo sapiens) [TaxId:9606] [88575] (63 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) |
Domain d1op3m2: 1op3 M:116-228 [87215] Other proteins in same PDB: d1op3h1, d1op3k1, d1op3k2, d1op3l1, d1op3l2, d1op3m1 part of Fab 2G12 complexed with box, man |
PDB Entry: 1op3 (more details), 1.75 Å
SCOP Domain Sequences for d1op3m2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1op3m2 b.1.1.2 (M:116-228) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)} tkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgl yslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
Timeline for d1op3m2: