SCOP 1.67: Domain d1op3l2: 1op3 L:108-212

Lineage for d1op3l2 (1op3 L:108-212)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88569] (74 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d1op3l2: 1op3 L:108-212 [87213]
   Other proteins in same PDB: d1op3h1, d1op3h2, d1op3k1, d1op3l1, d1op3m1, d1op3m2
   part of Fab 2G12
   complexed with box, man

Details for d1op3l2

PDB Entry: 1op3, 1.75 Å

PDB Description: crystal structure of fab 2g12 bound to man1->2man

SCOP Domain Sequences for d1op3l2:

Sequence; same for both SEQRES and ATOM records:

>d1op3l2 b.1.1.2 (L:108-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens)}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

Timeline for d1op3l2:

• d1op3l2 first appeared in SCOP 1.65
  
• d1op3l2 appears in SCOP 1.69
  
• d1op3l2 last appears in SCOPe 2.07