Lineage for d1oopa_ (1oop A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1141359Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 1141532Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 1141533Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
    the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
    there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)
  6. 1141795Protein Swine vesicular disease virus coat proteins [89225] (1 species)
  7. 1141796Species Swine vesicular disease virus [TaxId:12075] [89226] (2 PDB entries)
  8. 1141798Domain d1oopa_: 1oop A: [87204]
    complexed with myr, sph

Details for d1oopa_

PDB Entry: 1oop (more details), 3 Å

PDB Description: the crystal structure of swine vesicular disease virus
PDB Compounds: (A:) coat protein vp1

SCOPe Domain Sequences for d1oopa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oopa_ b.121.4.1 (A:) Swine vesicular disease virus coat proteins {Swine vesicular disease virus [TaxId: 12075]}
rvadtigsgpvnsesipaltaaetghtsqvvpsdtmqtrhvknyhsrsestvenflcrsa
cvfyttyenhdsdgdnfaywvintrqvaqlrrklemftyarfdleltfvitstqeqptvr
gqdapvlthqimyvppggpvptkvnsyswqtstnpsvfwtegsapprmsvpfigignays
mfydgwarfdkqgtygistlnnmgtlymrhvndggpgpivstvriyfkpkhvktwvprpp
rlcqyqkagnvnfeptgvtegrtdittmktt

SCOPe Domain Coordinates for d1oopa_:

Click to download the PDB-style file with coordinates for d1oopa_.
(The format of our PDB-style files is described here.)

Timeline for d1oopa_: