Lineage for d1ooaa2 (1ooa A:38-250)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 789808Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 790093Superfamily b.2.5: p53-like transcription factors [49417] (7 families) (S)
  5. 790148Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (6 proteins)
  6. 790152Protein p50 subunit of NF-kappa B (NFKB), N-terminal domain [49423] (2 species)
  7. 790156Species Mouse (Mus musculus) [TaxId:10090] [49425] (8 PDB entries)
  8. 790157Domain d1ooaa2: 1ooa A:38-250 [87193]
    Other proteins in same PDB: d1ooaa1, d1ooab1

Details for d1ooaa2

PDB Entry: 1ooa (more details), 2.45 Å

PDB Description: crystal structure of nf-kb(p50)2 complexed to a high-affinity rna aptamer
PDB Compounds: (A:) Nuclear factor NF-kappa-B p105 subunit

SCOP Domain Sequences for d1ooaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ooaa2 b.2.5.3 (A:38-250) p50 subunit of NF-kappa B (NFKB), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
ggpylqileqpkqrgfrfryvcegpshgglpgasseknkksypqvkicnyvgpakvivql
vtngknihlhahslvgkhcedgvctvtagpkdmvvgfanlgilhvtkkkvfetlearmte
acirgynpgllvhsdlaylqaegggdrqltdrekeiirqaavqqtkemdlsvvrlmftaf
lpdstgsftrrlepvvsdaiydskapnasnlki

SCOP Domain Coordinates for d1ooaa2:

Click to download the PDB-style file with coordinates for d1ooaa2.
(The format of our PDB-style files is described here.)

Timeline for d1ooaa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ooaa1