Lineage for d1ooaa2 (1ooa A:39-250)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767925Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2768236Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (7 proteins)
    automatically mapped to Pfam PF00554
  6. 2768240Protein p50 subunit of NF-kappa B (NFKB), N-terminal domain [49423] (2 species)
  7. 2768244Species Mouse (Mus musculus) [TaxId:10090] [49425] (7 PDB entries)
  8. 2768245Domain d1ooaa2: 1ooa A:39-250 [87193]
    Other proteins in same PDB: d1ooaa1, d1ooaa3, d1ooab1, d1ooab3
    protein/RNA complex

Details for d1ooaa2

PDB Entry: 1ooa (more details), 2.45 Å

PDB Description: crystal structure of nf-kb(p50)2 complexed to a high-affinity rna aptamer
PDB Compounds: (A:) Nuclear factor NF-kappa-B p105 subunit

SCOPe Domain Sequences for d1ooaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ooaa2 b.2.5.3 (A:39-250) p50 subunit of NF-kappa B (NFKB), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
gpylqileqpkqrgfrfryvcegpshgglpgasseknkksypqvkicnyvgpakvivqlv
tngknihlhahslvgkhcedgvctvtagpkdmvvgfanlgilhvtkkkvfetlearmtea
cirgynpgllvhsdlaylqaegggdrqltdrekeiirqaavqqtkemdlsvvrlmftafl
pdstgsftrrlepvvsdaiydskapnasnlki

SCOPe Domain Coordinates for d1ooaa2:

Click to download the PDB-style file with coordinates for d1ooaa2.
(The format of our PDB-style files is described here.)

Timeline for d1ooaa2: