SCOPe 2.05: Domain d1ooaa1: 1ooa A:251-350

Lineage for d1ooaa1 (1ooa A:251-350)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins)
   subgroup of the larger IPT/TIG domain family

6. Protein p50 subunit of NF-kappa B transcription factor [49248] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [49250] (15 PDB entries)

8. Domain d1ooaa1: 1ooa A:251-350 [87192]
   Other proteins in same PDB: d1ooaa2, d1ooab2
   protein/RNA complex

Details for d1ooaa1

PDB Entry: 1ooa, 2.45 Å

PDB Description: crystal structure of nf-kb(p50)2 complexed to a high-affinity rna aptamer

PDB Compounds: (A:) Nuclear factor NF-kappa-B p105 subunit

SCOPe Domain Sequences for d1ooaa1:

Sequence; same for both SEQRES and ATOM records:

>d1ooaa1 b.1.18.1 (A:251-350) p50 subunit of NF-kappa B transcription factor {Mouse (Mus musculus) [TaxId: 10090]}
vrmdrtagcvtggeeiyllcdkvqkddiqirfyeeeenggvwegfgdfsptdvhrqfaiv
fktpkykdvnitkpasvfvqlrrksdletsepkpflyype

Timeline for d1ooaa1:

• d1ooaa1 first appeared in SCOP 1.65
  
• d1ooaa1 appears in SCOPe 2.04
  
• d1ooaa1 appears in SCOPe 2.06
  
• d1ooaa1 appears in the current release, SCOPe 2.08