Lineage for d1ooaa1 (1ooa A:251-350)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 291481Superfamily b.1.18: E set domains [81296] (18 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 291482Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (5 proteins)
    subgroup of the larger IPT/TIG domain family
  6. 291483Protein p50 subunit of NF-kappa B transcription factor [49248] (2 species)
  7. 291488Species Mouse (Mus musculus) [TaxId:10090] [49250] (8 PDB entries)
  8. 291490Domain d1ooaa1: 1ooa A:251-350 [87192]
    Other proteins in same PDB: d1ooaa2, d1ooab2

Details for d1ooaa1

PDB Entry: 1ooa (more details), 2.45 Å

PDB Description: crystal structure of nf-kb(p50)2 complexed to a high-affinity rna aptamer

SCOP Domain Sequences for d1ooaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ooaa1 b.1.18.1 (A:251-350) p50 subunit of NF-kappa B transcription factor {Mouse (Mus musculus)}
vrmdrtagcvtggeeiyllcdkvqkddiqirfyeeeenggvwegfgdfsptdvhrqfaiv
fktpkykdvnitkpasvfvqlrrksdletsepkpflyype

SCOP Domain Coordinates for d1ooaa1:

Click to download the PDB-style file with coordinates for d1ooaa1.
(The format of our PDB-style files is described here.)

Timeline for d1ooaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ooaa2